PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100090130101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family GRAS
Protein Properties Length: 491aa    MW: 54868.1 Da    PI: 5.1626
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100090130101genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS432.43.5e-1321244914374
                          GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                                   lL+ecA a+++g +++a +++  l++++s +g+p +R+aay++eAL ar++ s+ +lykal++++ +   ss++l+a++++
  Ote100090130101|100090130101 124 LLFECAAAIQNGYFKEALQMIDVLRQRVSIQGEPSERIAAYMVEALVARITTSGRGLYKALKCKNPP---SSDRLSAMQVL 201
                                   8*****************************************************************9...9********** PP

                          GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetge 163
                                   +e++P+++f++++aN a+lea+  e+rvHiiDfdi+qG Q+ +Llq+La+ p+++p++R+Tgv++pes+  ++  l+ +g+
  Ote100090130101|100090130101 202 FEACPCFRFGFMAANGAMLEAFRDENRVHIIDFDINQGSQYYTLLQTLAKTPGKKPHIRLTGVDDPESVqrREGGLQIIGQ 282
                                   *******************************************************************99888899****** PP

                          GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveq 244
                                   rL+++Ae l+++fef++ +a +++ +++++L+++pgEal+Vn+++qlh+l+desvs+++ rd++L++vksl+Pk+v++veq
  Ote100090130101|100090130101 283 RLEQLAEDLQLSFEFHA-LAAETALVSPSMLHCQPGEALVVNFAFQLHHLPDESVSTTNLRDQLLRMVKSLKPKLVTLVEQ 362
                                   *****************.5999*********************************************************** PP

                          GRAS 245 eadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFk 325
                                   ++++n+++Fl rf+ea +yysa+f sl+a+l+r+s++ri+vE+++l+r+i nvvaceg+er+er e ++kWr+r+++aGF+
  Ote100090130101|100090130101 363 DVNTNTSPFLSRFAEAYNYYSAVFASLDATLGRDSQDRINVEKHCLARDIINVVACEGEERIERYEVAGKWRARMSMAGFN 443
                                   ********************************************************************************* PP

                          GRAS 326 pvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   p p+s ++  ++k l+++++++ y+v ee g l +gW+d+ L+  SaWr
  Ote100090130101|100090130101 444 PHPISGNVCGEIKKLIKQYSDR-YKVREETGVLRFGWEDKMLILSSAWR 491
                                   ********************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.01195472IPR005202Transcription factor GRAS
PfamPF035141.2E-129124491IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MPLVGSAAVY GNNSSGISTS MFSSDATTCT SGSSEDLMHT SSLVTLRENV HEFDHEFHSQ  60
SREVVDYDSD EMKLKLQELE KALLDDNQSM EIEGGLPDTT SYALLQNSPT ESSSSDSTLP  120
PKMLLFECAA AIQNGYFKEA LQMIDVLRQR VSIQGEPSER IAAYMVEALV ARITTSGRGL  180
YKALKCKNPP SSDRLSAMQV LFEACPCFRF GFMAANGAML EAFRDENRVH IIDFDINQGS  240
QYYTLLQTLA KTPGKKPHIR LTGVDDPESV QRREGGLQII GQRLEQLAED LQLSFEFHAL  300
AAETALVSPS MLHCQPGEAL VVNFAFQLHH LPDESVSTTN LRDQLLRMVK SLKPKLVTLV  360
EQDVNTNTSP FLSRFAEAYN YYSAVFASLD ATLGRDSQDR INVEKHCLAR DIINVVACEG  420
EERIERYEVA GKWRARMSMA GFNPHPISGN VCGEIKKLIK QYSDRYKVRE ETGVLRFGWE  480
DKMLILSSAW R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-581254918375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101883.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101887.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101891.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_011101898.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A022QX640.0A0A022QX64_ERYGU; Uncharacterized protein
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429